SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007675 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007675
Domain Number 1 Region: 70-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007675   Gene: ENSPMAG00000006965   Transcript: ENSPMAT00000007709
Sequence length 135
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477733:7953:11093:-1 gene:ENSPMAG00000006965 transcript:ENSPMAT00000007709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQSSACGNPGAPPHGTVHGAGFGVGDEIRYGCVPGYVLEGHAVLTCVSGAESLASWDFP
VPHCKAEGACGGTPHGPSGTISSPGFPNEYDNKASCTWLVLGVPGDTVSLVFTDFQLEAG
YDFLEVSGAELPSVW
Download sequence
Identical sequences S4RR39
ENSPMAP00000007675 ENSPMAP00000007675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]