SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007884 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007884
Domain Number 1 Region: 170-432
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-54
Family YWTD domain 0.0000000958
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 87-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.006
Further Details:      
 
Domain Number 4 Region: 123-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 5 Region: 45-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007884   Gene: ENSPMAG00000007160   Transcript: ENSPMAT00000007919
Sequence length 547
Comment pep:novel scaffold:Pmarinus_7.0:GL483572:771:12321:1 gene:ENSPMAG00000007160 transcript:ENSPMAT00000007919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEACGASELRCTDGSCVPGSSQCDGFRDCHDGSDEHDCNNTAVDCTGPGWFRCRSGECLQ
DRQVCDGKRDCHDWSDEPLSLCNVNECATTNGGCSHTCWDRPLGYECGCPAGYELLDEYT
CGDTDECKQPGVCSQLCINYKGGYKCDCYEGYTMDPATQACKATEHQKTYLIFANQRDVR
RVDLHTRSYKQLISRTRNTVAVAVEITANRIYWSDLGQKQVYSAHMDEAHDSTRHTSVLG
EAPVFVEGIAIDWVHGNLYWTDSKAKTVAVAKPDGSRRRTLFGQGLSEPRAIAVDPLSGF
VYWSDWGQPAKIEKAGMNGVSRQVIVSKDIEWPNGITLDLVNKRLYWVDSKLRTLSSVNL
AGGERHEVMHQTDALHHPFAIAIFEDKVYWADGEKEAIYSADKHTGSGISSVVEDLHSPQ
DLLVYHPLLQPNDRPPVVVMTTGPKDVTSREPQRTSPRPATASSSSTTTTTLSGTNSISF
ESLADMLARKEEASTSVVPVALGITIPIVLLLLLAAGAVMLWRSWKRRSAKSIHFENPVY
RKTTEEQ
Download sequence
Identical sequences S4RRP8
ENSPMAP00000007884 ENSPMAP00000007884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]