SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008002 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008002
Domain Number 1 Region: 146-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 20-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 3 Region: 80-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008002   Gene: ENSPMAG00000007272   Transcript: ENSPMAT00000008038
Sequence length 238
Comment pep:novel scaffold:Pmarinus_7.0:GL483803:310332:314776:1 gene:ENSPMAG00000007272 transcript:ENSPMAT00000008038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVACVEGQWDKRVACLPVDCGVPSSHLVYHADFSYPHGTSYSARTTFVCRPPAILQGAS
AELQCQEDGLWSLPEAYCQLTCRAPPPMPNAVARTERCKHDGQKVGSSCKYRCKPGYHVL
LTSRKPRPWVFKVKCTEEGHWEEGGCVPVQCPPLPLVLHGSYTCTHRFQFGSRCWVNCST
GNPMDQQGHKVIECRKNGRWSGELQLCPHVQGECTTPDPPFIIEFDCPTGYGIGNSVA
Download sequence
Identical sequences S4RS15
ENSPMAP00000008002 ENSPMAP00000008002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]