SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008089 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008089
Domain Number 1 Region: 16-174
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-22
Family YWTD domain 0.00054
Further Details:      
 
Domain Number 2 Region: 254-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000013
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008089   Gene: ENSPMAG00000007344   Transcript: ENSPMAT00000008125
Sequence length 290
Comment pep:novel scaffold:Pmarinus_7.0:GL477999:52001:55120:-1 gene:ENSPMAG00000007344 transcript:ENSPMAT00000008125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TATNVFPVCAASRAVQGVRDVAVDWSGENIYWLSADRPTVEATRLDALSARAVVVLSGSL
QWPASLALDPSSGTMCLSDWGQAGAGGGGAWIECSRMDGTERRVLISFEGVARPDSLVMD
ANQSLLLWADEGLGMIQSIKLDGSDHKILHRGLPRIAGLAVVDGALFWVVNNNRKSSELW
REGGDRPWVQLRQRVMDVAASRTPHPADGLACRHIRCEHTCLVRRHGEVVCACPPALAVE
RTTSGSVACVPPSRCERPERRRCGDGGCVPALLWCDSVRDCDDGSDEEGC
Download sequence
Identical sequences S4RSA0
ENSPMAP00000008089 ENSPMAP00000008089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]