SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008117 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008117
Domain Number 1 Region: 103-212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-31
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-26
Family Link domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008117   Gene: ENSPMAG00000007366   Transcript: ENSPMAT00000008153
Sequence length 231
Comment pep:novel scaffold:Pmarinus_7.0:GL476334:831106:837761:-1 gene:ENSPMAG00000007366 transcript:ENSPMAT00000008153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVAGVFHYDQGRRYSLSFPEARRACAEVFGAALASRQQLATAMRAGMEDCRAGWLAAREV
AYPRIHATWRCGQHRTGIISYGVRNASTERWDVFCYGFGDDTCGGVLAWTRAGEIRSPGF
PRAYPSGADCTWEVRAPPEFTLRLAVQALGLEERRHCDYDSLGVYDGTGAGRRLLGRFCG
FKLPLPLLSSGNSLTLVLKSDASVEHEGFSAKLTLVKLKIHNNKDLNYTYT
Download sequence
Identical sequences S4RSC8
ENSPMAP00000008117 ENSPMAP00000008117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]