SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008271 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008271
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-21
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 2 Region: 406-441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 3 Region: 365-400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 213-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 292-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 180-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 259-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000008271
Domain Number - Region: 134-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008271   Gene: ENSPMAG00000007520   Transcript: ENSPMAT00000008309
Sequence length 441
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL484902:8618:12574:1 gene:ENSPMAG00000007520 transcript:ENSPMAT00000008309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVYWTTWSPHPVIERATLAGNFRTSIVNSSLAWPISLTIDLPDGMLYWADAYLQRIERAS
LSGSHRELVLGSLAFPCALSVHGQHVYWTDWEDRAVFRASKHDGSGRLTLLRDLPHRPSA
LKVMARSRQPACDNPCQRFNGGCSHVCAPGPSGPECQCPMEGNWVLANKARDCVPSEAVP
CPHFLCGNGRCVAERGTCDGRDDCGDNSDETERLCALRTCAATDFVCDSGRCLSYAHRCD
FRDDCGDGSDERGCAHSACDPAAEITCANGRCVALEFVCDGADDCRDNATTDERDCPVTS
CLPGYVRCQTSSRCVRRAYLCDGDDDCEDRSDENPAFCRESACPRVRIFPCPRDVRCSPR
RGAVGVSCPPEDFRCKLGRCVPLSWVCDGTADCADSSDEPRSCSALERTCHADQFACASG
RCVPADWRCDGDDDCGDGSDE
Download sequence
Identical sequences S4RST1
ENSPMAP00000008271 ENSPMAP00000008271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]