SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008412 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008412
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-36
Family G proteins 0.0000682
Further Details:      
 
Domain Number 2 Region: 144-183
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000314
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008412   Gene: ENSPMAG00000007649   Transcript: ENSPMAT00000008450
Sequence length 236
Comment pep:novel scaffold:Pmarinus_7.0:GL485364:3390:6790:-1 gene:ENSPMAG00000007649 transcript:ENSPMAT00000008450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVGVTCKTTTILLDGRRIKLQLWDTSGQGRFCTIFRSYSRGAQGIVLVYDITSRWSFDGI
ERWIKEIDEHAPGVPRILVGNRLHLAFKRQVSTEQAQAYAERHSMTYFEVSPLCNFNITE
SLTQLSRIALMRHGMERLWRPNRVLSLQDLCCRSIVSCTPVHLIDKLPLPVTVKSHLKSF
SMANGMNAFTMHGHSYFPHTSNAGKRSSLKKSPSIKVTRPVLSPPESCTRNSCKIS
Download sequence
Identical sequences S4RT72
ENSPMAP00000008412 ENSPMAP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]