SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009057 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009057
Domain Number 1 Region: 265-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 2 Region: 323-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.83e-16
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 3 Region: 137-197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000367
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 79-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000175
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 209-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000059
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009057   Gene: ENSPMAG00000008231   Transcript: ENSPMAT00000009096
Sequence length 381
Comment pep:novel scaffold:Pmarinus_7.0:GL479728:66801:80742:-1 gene:ENSPMAG00000008231 transcript:ENSPMAT00000009096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQCKCAYMYDPDSGVAECLAGCGPPPRVNNGRPDSTNTFFPVNDMVRYQCNSGYAATKNS
SLRLQCVANGTWGELNYWCERKTCSPKPIDQGSYTGGISFGDTITYTCDTGYALTGKTYQ
LTCMADGTWNPVDPPDCQSVSCPEIDLTEKLVFQLSLQYQYGSRVTYSCEAGFSLIGDSF
RDCLESGKWSGSNPICKVSDVKCKTPQWDISHGQAMGERKEAYKYNDIVRYECSARYRAE
PSEIHCTESNEWSATVNCVFKAVTVCRSPPLIGNGDVVQPKSEYAMGDSASYKCRKGYRL
EGNETAVCRENDQWTQPPTCASVTCGPPATVINGKIKEQAKTPYAYGDRVSYICDDTYHL
VGNGEITCQNNGQWSPSPSCA
Download sequence
Identical sequences S4RV17
ENSPMAP00000009057 ENSPMAP00000009057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]