SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009073 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009073
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily L domain-like 1.4e-18
Family Ngr ectodomain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009073   Gene: ENSPMAG00000008241   Transcript: ENSPMAT00000009112
Sequence length 94
Comment pep:novel scaffold:Pmarinus_7.0:GL478699:55675:56821:1 gene:ENSPMAG00000008241 transcript:ENSPMAT00000009112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQCSCYGRIVNCNSRSLASLPAGIPTTTQSLGFYNNQITKLEPGVFDHLVNLQGLGLQN
NQLKSILPQGVFDRLVHLKWSSLTSNQLKSVPRG
Download sequence
Identical sequences S4RV33
ENSPMAP00000009073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]