SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009259 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009259
Domain Number 1 Region: 701-758
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 8-48
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000034
Family Somatomedin B domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000009259
Domain Number - Region: 44-116
Classification Level Classification E-value
Superfamily E set domains 0.00518
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009259   Gene: ENSPMAG00000008406   Transcript: ENSPMAT00000009299
Sequence length 800
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476720:48117:75970:1 gene:ENSPMAG00000008406 transcript:ENSPMAT00000009299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVKAEGNCASRCGQVTLGDCSCTPSCQALDSCCPDFAHRCLEISPKSGCHVGGDDLKI
INIRFNRTQGVICRFGEDKVDVGGHLDGEGHAHCVSPLVYETRRIPFQLSVDGGLSFPHE
GTWVAVHPGKVKGGAAAQMHNATHWQYYGTPGVAGKLTLNWNASKLRSPAVNVEVWGYRE
TGEAYGAAWVAQWLYLYTLARDVANSGSFTFLPKPALPEFSVYEFGMLRIASSNYSDGQP
NVLAAWSDDHAMAWHLEEKFRADPAAWALQKCLAWNENETSILPPFLPEIADCPCTLGQA
RADTGRFQADYGCDIDKGSKCTYHQGAVHCVRAIQASPRYAAGQQCCYDARGVQLLTVDS
VGGGTPDRGHDWGSPPYRRPPRVPAASHWLYDVVTFYYCCLWSDNCDYYMHHRPSSDCRA
YVPPKIGSALGDPHFLTFGNLSITFNGRGEYTLLEAASHSLVVQIRTDVAHDPDGNAVNA
TVITSAAMRENGSDLVEVRVQRESGTLQVLLNGGAVAFDEQDWMDLHGVFVNSAVMSNVT
VMFPSGAAVEVRLMPGSLAVSLLLPRNFSGQTRGLLGVLDGGLSFPDGTTLPGDASPEQM
YSFGASWTLHRRNGVATTSSWKARHSLLMIVAPLLDPNCKAAQGSSTRWQPAGSTQGGSL
QGSTKFQPFKIYTLSSLSAANATLLAHRWHQGVARDLAPVVSCGVLLAPKHGSKEGTVYM
AGGRLTFACDSGYTLSGSSTRECRPNGRWSGQDVSCVTDNTLAIVLGSVFAVLVLAIAGF
FIYKQLRMRHNRVHCSGGKP
Download sequence
Identical sequences S4RVL9
ENSPMAP00000009259 ENSPMAP00000009259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]