SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009396 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009396
Domain Number 1 Region: 10-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-34
Family G proteins 0.0000918
Further Details:      
 
Domain Number 2 Region: 155-194
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000196
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009396   Gene: ENSPMAG00000008528   Transcript: ENSPMAT00000009436
Sequence length 256
Comment pep:novel scaffold:Pmarinus_7.0:GL476782:319637:323422:1 gene:ENSPMAG00000008528 transcript:ENSPMAT00000009436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCLVSAGVVCTSTTILLDGRKVKLQLWDTSGQGRFCTIFRSYSRGAQGIVLVYDITNRWS
FDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRRVSTEQAQAYAERHAMTFFEVSPLCNF
NITESLTELSRIVLMRHGMERLWRPNRASLMATAVLSLQDLCCRSIVSCTPVHLIDKLPL
PVTIKSHLKSFSMANGMNAFTMHGRSYSVHAAAGAGGAGGGAAAKRSSLKKSASIKGPRP
PLSPQTNCSHNSCKIS
Download sequence
Identical sequences S4RW06
ENSPMAP00000009396 ENSPMAP00000009396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]