SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009460 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009460
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 220-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-19
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 3 Region: 121-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009460   Gene: ENSPMAG00000008591   Transcript: ENSPMAT00000009500
Sequence length 362
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL481336:529:7336:-1 gene:ENSPMAG00000008591 transcript:ENSPMAT00000009500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACGSMMEEMSGPSGVIHSPGWPTAYPGSLNCSWFIRAQPGHVITIRGGSFTGFEMEGSEG
CTADWLMLGPGSRGAHDYRACGSALPPPFISPRDHVWIKFHSDASASGSGFELRYVTSLL
QATQCPDDQLRCANGRCVLRTWECNGQDECGDGSDERGCKPNLAQLSGFEKSYVGVYLCV
SADCTMRCNPINIYADVSLECSSCALDYPCGTIGGPENAPCGSHWLRNFYGWFSSPRYPH
AYPAGANCRWVINTDDARPLVLLFVDLQLAPGSTDTLEVFEGLNGGNDSDAGFGSEVAVK
PLVQLTGLKRYDLPVSVQTASGQVVVRFFSDRRSSSARGFNATYRVAGYCPPLQHPCGGG
EG
Download sequence
Identical sequences S4RW70
ENSPMAP00000009460 ENSPMAP00000009460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]