SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010277 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010277
Domain Number 1 Region: 1429-1536
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 1774-1894
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 3 Region: 1955-2063
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 4 Region: 563-667
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 5 Region: 727-842
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-30
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 6 Region: 2121-2239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-29
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 7 Region: 74-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 1252-1364
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 9 Region: 905-1015
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 386-496
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1086-1188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-24
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 12 Region: 2307-2411
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1597-1712
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-21
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 14 Region: 2661-2729
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 15 Region: 2777-2843
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-18
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 16 Region: 2718-2787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 3016-3087
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 3076-3145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 323-395
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-16
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 20 Region: 2602-2671
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000126
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 21 Region: 2900-2968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 22 Region: 2413-2486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000132
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 23 Region: 501-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 24 Region: 3198-3266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 25 Region: 2957-3021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 3128-3191
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 27 Region: 2067-2131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000127
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 2549-2613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 29 Region: 1369-1434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1542-1606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1021-1083
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000378
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 2832-2893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 1192-1256
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000621
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 1893-1961
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000695
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 35 Region: 671-737
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000723
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 36 Region: 848-912
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000118
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 37 Region: 10-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000189
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 38 Region: 1719-1789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 39 Region: 2475-2541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 40 Region: 3257-3315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000542
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 41 Region: 2238-2301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000445
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010277   Gene: ENSPMAG00000009333   Transcript: ENSPMAT00000010323
Sequence length 3556
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476365:125003:472029:-1 gene:ENSPMAG00000009333 transcript:ENSPMAT00000010323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYLQVLQIHSCGNPGVPPDGIMHGEHFNIGDKVRYSCAKGHVLEGQPIVTCVVYSGNNVA
WDFPIPQCRAEGACGRTLRENSGVISSPNYPSEYGNDADCTWIVLAEQGDTISLVFNDFQ
LEERFDSLEVEGADPSSIWLTGVGLPSPMISSKNWLRLHFVSNSNNSLRGFTAQYQVNQN
LKSNTLTSETERSILPREEALAKCGTRLLKEITVKVTTQNLLNRSSNSAGRTVTQNSRPH
ADRQTGKYFLPPPPAQDASLNPAQSRHAHGNHVKLNFKIYIVQRAVKRAIDLRTKGGKVT
QIKDKAKYSMTGKNRSSTHASSTCPDPGEPQDGRRVGADFRLGATVRFSCNEGYVLQGSS
SIICQRVNEIFASWSDNTPKCKGITCGAALTGPSGTITSPNFPVQYDNNAQCVWTITASR
PSKVIEINFEEFDLERGFDTLTVGDGEEVGDPRMVLHVLTGTSVPDLVVSMTGHMWLHLQ
TDDSAGSLGFKIIYREIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTI
TCQSNNQWSANVPHCIFPCVFNFTSPIGIVLSPNYPEHYGSNMNCIWLIVAPAGSRIRLV
FADFEVESQFDFLAVKDGDRHDAPLLGTFSGADVPGNLVSASNTFRLEFLSDHSTPGRGF
NISYTTFGHNDCYDPGNPVNGRRFGTKFHLGSMVSFTCEKGFIRTEGSEILTCVSRDGNI
EWNENVPKCEAPCGGHLTSLAGIILSPGWPGLYKDSLSCEWIIEAQQGHAIRLIFKSRFQ
TEVNYDVLQIYDGASTSSPLTGSFHGTQVPEFLASTGNTLLLHFTTDNSRSNVGFQILYE
SITLSTHLCLDPGVPVHGQRHGTEMSVGSMVTFSCNSGYTLSHEEALICDKNLQWSHPMA
SCDAPCGGYIHASSGIILSPGYPDYYPNTLNCTWTVEVSHGKGVQFTFHTFHLESSHDYL
LITENGSFSQPLARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNITFTEYNLEP
CKDPGMPAYSRREGSTFTVGDVLSFSCFAGYRLVGMPKLTCQGGGRHVWSSPLPRCVAEC
GMSSIGTDGELLSPNYPGSYDRKHECIYTIETEAGSGIRLMAKTFRVAEGDFLKVYDGNS
SLAPLIGTYSKTEFQGLSLNSTSNRLWLKFDTDSEGTEKGFRLIYSSFELTHCKEPGSPE
FGYKIREQGHFAGGTVAYGCNPGYNLHGSSTLTCMTGSRRTWDHQLPSCVAECGGKIQGA
TSGRILSPGYPAPYGHNLQCTWEIHANAGYTISLHFVVFDTEAAHDLLKVWDGPSVPSQA
GVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQFSSAVARACRDPGVPTNST
RSGTGREPGNIITFQCQPGYQLQGEATIVCMHGENHYYWQPDPPTCIAPCGGNLTEPTGF
ILSPNYPEPYPPGKECDWQVTVTADNVISLTFISFDTETSYDFLHIYDGPGSSSPLIASL
QGSKLPGRIESTGNSMFMAFRSDDSLSLSGFHIEYKEKPQESCFDPGNIQNGSRLGTDVK
LRSTITYFCDAGYTIQGYSTLLCVMSEDGRPMWNRPLPSCHAPCGGKATASEGVVLSPGY
PRNYSSPQHCVHTITVPKDFVIFGQYATFETSVKDVVHVYDGPTQSFFLLSALSGSHTGK
VIPLSSSHQITIVFSPSKGSSARGYHFVYRAVPRTSATHCTSISEPLHGRRIGLDFSANS
IVRFECNPGYTLKGAQAIQCTTVANALAQWNDSLPTCYAPCGGNLTIYTGTILSPGYPEM
YDNNLDCVWRIIVPEGDGIQVQFVNFATEHNWDTLDIYDGPDVNSPKLGSFSGTTVPTFI
NSSSNQLYLHYQTDLSLGIVGFHVKYSAIGLSSCSEPNTPSNGIKMGNSFLVNDIMSFEC
EPGFKLQTQGHKHIMCMPGPVRRWNFPPPICTAVCGGTMTEFNGIILSPDFPGNYPSNVE
CHWKIELPIGYGVYLQFENFTTELDHDYLEIRTEIAQVSSTIGRFSGPTVPAALLSTTHR
TTMHFHSDYSQSKPGFKIFYEAYELQNCPDPKPFRNGFVVGSNFGVGHSISFECFSGYVL
IGQSILTCQHGVNRNWDHPFPSCIAPCGGNVTGMSGTVYSPGFPDEYPNFQDCVWMVKVA
YGHGVYINFTLLRTEPVYDFITIWDGPEQNAPQLGQFSGNTALESVYSTSNQILLKFHSD
FSTGGFFVLSYYAYQLRVCQLPPSVPHAETLMQDKELEIGDTVHYRCEAGFTMLYSDVLT
CQLRARLQMDTTPPACEALCPTNEVRTESVGVILSPSYPANYPYLQTCLWTISVEKTYNV
TLFIELFQSEKQYDELEIFDGGQSSQSPRLLALSGDYSAPISVTSTGHQVHLRWASDQAT
SKKGFRIRYTAEYCSIPAAPAHGSVMSQSGGHLNSVVWWACDRGYTLIGKSSAVCIKAPQ
GFHMWDSAVPTCQAISCGIPVSPANGEILTVNYSIGGRVTYGCNRGYTTGPGDTLAAVCL
ENGTWSNNNQPPMCNAIACMDFNAFSLDHGSWLLLNGSDYKYGSRIIFHCQPGYTLLGPR
IIQCQENGAWSWENDRPRCSLISCGSLSALPNGRKIGTQTGFGSTAIYRCDPGFTLLGSQ
VRECLASGLWSGTSNRCIAGHCGVPDPVTNGAVVGQSFGYHDTVVYRCQPGFRLVGSSVR
MCQQDHQWSGQPPACVPISCGHPGTPVHGLTEGSSFHLYDTVNFTCNSGYISEGASQAQC
MPDALWSQPLPTCKVVSCPDPGEPLNGVRKVNKGYGKFVFGSVVFYDCKQGFYLIGSSVL
TCLPNGLWDRPIPQCFLVSCGHPGVAPNSLLSGEKFTFGATVIYSCTGSRLLIGNATRSC
QADGRWTGAQPHCSGDSAGSCGDPGIPSHGHRIGEEFRVKSVVRFGCAVGYALHGPSERV
CLPSGSWSRSQAECKAVWCGNPGVPAGGSILHSDGVVFSSSVTYACWDGYQMSGLSTRLC
SANATWTGVLPVCTVISCGNPGVAANGFYLGKEFTFSQNVSYHCYPGYSMSSGATAVRSC
QKDGTWSGALPSCHVITCRQPPRVLNGRLLGSDFSWGASVSYSCSSGYEPSFPATLTCEG
NGTWRGDVPQCLPIYCGDPGVPAEGRREGTSFMYKSKVAFSCKNTLLLVGSSLRMCTADG
TWSGTQPRCIDLDPLQNTCPNPGALQFGELNSTFGFQVGSKVKFRCGKGYHILGSTTRSC
QSDYVWSGTRPQCIPHSCRQLETPENADVGAVELPGLGYTLMYSCQPGFYLAGGSEHRSC
RPDGTWSGKTPICHPGLKPSEKNNSALLTTHSPQGAALDVTLFEESVWKGSFDFRDTKRP
ASLLTNSIDVNSGRLNLTFLATNMELKVAGVFKNKEGNVFLRVTHVKRFDQSLFEKMPGD
WSMNGSVTTDIDGVTHVYQGFIQAKEYGSFGFKKIGAETRGPEGGTDPTGQQHGTSSSSV
AVAILVPFFALILAGFAFYLYKQRSAPKPHFSGFADHENSNGQTAFENMIYDSSLKHGES
KAVRFDPRLNTVCTVV
Download sequence
Identical sequences S4RYI6
ENSPMAP00000010277 ENSPMAP00000010277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]