SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010295 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010295
Domain Number 1 Region: 135-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-40
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 75-132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 27-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010295   Gene: ENSPMAG00000009364   Transcript: ENSPMAT00000010341
Sequence length 328
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL478021:14492:51134:1 gene:ENSPMAG00000009364 transcript:ENSPMAT00000010341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSKMDPPPYAGIRYMGLSYRQVQLMRLMPIRYEIEYVCKAGREIQGPHVRKCLPNGTWS
DMGTETKCLRLCPEMPPDFSNGRAEIVEGSARATEGTHIEYSCDEGYRLVGPPALYCTKA
GVWDGSIPHCVENRAPAGAKQALYIGGLFPMSGSWPGGQACKPAAMMALDDVNDKPDLMS
DYELKLIETDSMVWPGHATKILYDLLYYGPIKIVLMPGCSSVSTLVAEAARMWNLIVLSY
GSSSPALSNRQRFPTFFRTHPSATLHNPTRVHLFKTWGWTRIATIQQTAEVFTSTLADLE
ESVKEAGIEINVRQSFLSDPSVAVKNLK
Download sequence
Identical sequences S4RYK4
ENSPMAP00000010295 ENSPMAP00000010295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]