SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010760 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010760
Domain Number 1 Region: 192-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 2 Region: 87-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 3 Region: 1-34
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 4 Region: 280-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 38-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 122-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 7 Region: 231-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010760   Gene: ENSPMAG00000009790   Transcript: ENSPMAT00000010806
Sequence length 314
Comment pep:novel scaffold:Pmarinus_7.0:GL481091:16882:21357:-1 gene:ENSPMAG00000009790 transcript:ENSPMAT00000010806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGATEFRCASTGRCIPAVWACDNQDDCGDGSDELCAASCGPQQFPCSDGRPPETCVWTSE
RCDGQPDCANGEDERGCPAPPSCGGGCAWTEFRCRAGRCLPYLHRCDGHDDCGDFSDEEG
CSCPAGWLQCPDGLCLSPLRVCNGRADCRPAVDEAFCGHPGGGGDDPGIELESPGSEHTI
PLPCMRSAPARSPCKDTEFACASGECRPLAWRCDGEADCRDGSDERGCDGTCGPGEVPCP
GGPGGGGGGGQCLRHAELCDGIPHCLDFSDESLDRCGSAQIPPCPGNFECNNRTCVNASK
VCDGIPDCPDAEDE
Download sequence
Identical sequences S4RZW9
ENSPMAP00000010760 ENSPMAP00000010760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]