SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010763 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010763
Domain Number 1 Region: 105-350
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-85
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 21-116
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000876
Family Hepsin, N-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000010763
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0038
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010763   Gene: ENSPMAG00000009793   Transcript: ENSPMAT00000010809
Sequence length 389
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477028:5206:15491:-1 gene:ENSPMAG00000009793 transcript:ENSPMAT00000010809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNGVRDCVNGTDEQGCGRAARSSGDQAYLQVWNTAAGVFSMVCVENFTSAYAEQACVLMG
YDSRGSVTWSSIAPSAGAVVAVSNGAADSANLQLVYAPSNCPGNVVSISCLACGSSIKST
SRIVGGQDAQLGSWPWQVSLQFNGQHTCGGTLLTPTWVLSAAHCFQGYLGPDMWNVTDLT
SNLAGSISKIITNSQYVDNTNNDYDIALVKLSKPLSMSNTIGPACLPNYQTDFQVGMNCW
ITGWGATKVSAGPASTTLQEVMVPILSTETCNAANSYNGQITSRMVCAGFMQGGQDACQG
DSGGPLVCQTGTTWFVVGATSFGEGCALTNFPGVYSRVTAYLDWIHGTMQARHTLYYGKR
RGLYIPSPRQASPVQRWDHFAWPRYSSPA
Download sequence
Identical sequences S4RZX2
ENSPMAP00000010763 ENSPMAP00000010763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]