SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010769 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010769
Domain Number 1 Region: 62-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-80
Family Thrombospondin C-terminal domain 0.000000588
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000366
Family TSP type-3 repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010769   Gene: ENSPMAG00000009798   Transcript: ENSPMAT00000010815
Sequence length 229
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479156:19987:27729:-1 gene:ENSPMAG00000009798 transcript:ENSPMAT00000010815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDNDGVPDYLPPGPDNCRLVVNPNQEDNNGDGVGDVCESDFDNDSVIDRIDVCPENAEIT
LTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTVNSDPGLAVGYTAFNGVDFEGTFH
VNTVTDDDYAGFIFGYQDSASFYVIMWKQTEQTYWQATPFRAVAEPGLQLKAVKSKTGPG
ERLRNALWNTGDTGDQVTLLWKDPRNVGWKDKTSYRWHLAHRPQVGYIR
Download sequence
Identical sequences S4RZX8
ENSPMAP00000010769 ENSPMAP00000010769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]