SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011029 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000011029
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily L domain-like 0.00272
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011029   Gene: ENSPMAG00000010046   Transcript: ENSPMAT00000011075
Sequence length 41
Comment pep:novel scaffold:Pmarinus_7.0:GL481478:5884:6006:-1 gene:ENSPMAG00000010046 transcript:ENSPMAT00000011075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWDCECSDILYLKNWIVQHASIVNPLGNGGVDNVKCSGTKS
Download sequence
Identical sequences A5HIC9
ENSPMAP00000011029 ENSPMAP00000011029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]