SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011056 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000011056
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily L domain-like 0.00204
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011056   Gene: ENSPMAG00000010073   Transcript: ENSPMAT00000011102
Sequence length 41
Comment pep:novel scaffold:Pmarinus_7.0:GL481478:27362:27484:-1 gene:ENSPMAG00000010073 transcript:ENSPMAT00000011102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWDCECSDILYLKNWIVQHASIVNPSGHGGVDNVKCSGTKS
Download sequence
Identical sequences A5HIB8
ENSPMAP00000011010 ENSPMAP00000011056 ENSPMAP00000011010 ENSPMAP00000011056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]