SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011282 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000011282
Domain Number 1 Region: 13-58
Classification Level Classification E-value
Superfamily L domain-like 0.0000217
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011282   Gene: ENSPMAG00000010301   Transcript: ENSPMAT00000011328
Sequence length 62
Comment pep:novel scaffold:Pmarinus_7.0:GL476660:120079:120264:-1 gene:ENSPMAG00000010301 transcript:ENSPMAT00000011328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPSQCSCGEQSWAPGLQATNCYDKGLSSVPAGIPDNTQALTVQKNRIESLPERVFDSVG
SQ
Download sequence
Identical sequences A5HHG9
ENSPMAP00000011282 ENSPMAP00000011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]