SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011422 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000011422
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily L domain-like 0.000000016
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011422   Gene: ENSPMAG00000010441   Transcript: ENSPMAT00000011468
Sequence length 34
Comment pep:novel scaffold:Pmarinus_7.0:GL478443:22205:22306:-1 gene:ENSPMAG00000010441 transcript:ENSPMAT00000011468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYLDNNLLTKIPSGFFNRLSKLRLITLHGNPWAC
Download sequence
Identical sequences A5HH00
ENSPMAP00000011422 ENSPMAP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]