SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002021 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002021
Domain Number 1 Region: 409-554
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-43
Family Toll/Interleukin receptor TIR domain 0.00000546
Further Details:      
 
Domain Number 2 Region: 88-349
Classification Level Classification E-value
Superfamily L domain-like 4.28e-25
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002021   Gene: ENSPMAG00000001845   Transcript: ENSPMAT00000002031
Sequence length 565
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL489154:5157:7226:-1 gene:ENSPMAG00000001845 transcript:ENSPMAT00000002031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLFAPLPRLSRLRNLEFFRGKFNENLHYLILKHLQRSAVEALALTAVDFAYSAVTERPRV
PVGKLPLRTLAFRDITNPEVLLYNGNFNWYGSLDTLTINNVNFNVVPCPAWAAMHRVVTA
DISNNRLTDSALLNVGCDYRGTVPLLRSLLLADNALTRLATVAQLAREWGALRNVSLARN
SIGGAVERCNWSQPIEWLDLSYNRAAGDVYDCLPLTLRHLDLSFSDVDRLDLGYFARADR
LECLLLSGNNIKFIPSGWRAPVLRFLAIDRNSFGVIDRGTFELMVLLRSLRADNNPFQCT
CDLWGFLSEVRALDSPVRLEGWPNNYTCYHPAQLLGTQLERFRPGSLECDVRLVVLVSAV
VTAALAVACLALCRRFDVPWYVRALWNLLRSKRRKLTRGGGRQFAPGGRDYRFHAFISYS
HEDAAWVRENLMPQLESARPPLRVCVHERDFTPGMWIIDNIIDSIELSRKVIFVLSSAFV
DSEWCNYELYFAHQRPAHDAMEDLVLLLKEPIRPESLPSRFCKLRKLLSKKTYLEWPAEA
TKQSFFWAQLRAILRKASLSVNIVL
Download sequence
Identical sequences S4R9Z0
ENSPMAP00000002021 ENSPMAP00000002021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]