SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003036 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000003036
Domain Number - Region: 14-83
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00539
Family Protein-L-isoaspartyl O-methyltransferase 0.048
Further Details:      
 
Domain Number - Region: 108-126
Classification Level Classification E-value
Superfamily SOCS box-like 0.0706
Family SOCS box-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003036   Gene: ENSPMAG00000002789   Transcript: ENSPMAT00000003051
Sequence length 233
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL492436:2311:4756:-1 gene:ENSPMAG00000002789 transcript:ENSPMAT00000003051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLCMCRFELCEPRFVVGNCLEMRVESVQYDRVYCGAGVQKDHENFMKNLVRVGGILVMP
MEDQLTQITRTGQNAWDVKNILAVSFASLVLPGTTRMDGGGICLPLLEVRSLQDLARLAI
RHTLRELINAETGGQGFYSSPRPPKPRRKRRRPRGRRINTFVFVGNQLLPHHFDSDYESD
EARAEEGGGGGGTGDGARRLAGEEPERNFLRERVLALPLPEPLKAFLLYFRDK
Download sequence
Identical sequences S4RCV4
ENSPMAP00000003036 ENSPMAP00000003036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]