SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003222 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003222
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily C-type lectin-like 4.56e-44
Family C-type lectin domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 127-187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003222   Gene: ENSPMAG00000002956   Transcript: ENSPMAT00000003237
Sequence length 189
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956 transcript:ENSPMAT00000003237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCEPGWHGFGGRCYRYVAERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQWIG
LNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPF
CCETQPGRCGHPPIVSNARCFGAPHGRYAVGASVRYRCRAGFLQRHANPTSRCRPDGSWE
RPRIACVPR
Download sequence
Identical sequences S4RDE0
ENSPMAP00000003222 ENSPMAP00000003222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]