SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006134 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006134
Domain Number 1 Region: 113-487
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.37e-70
Family Ankyrin repeat 0.000026
Further Details:      
 
Domain Number 2 Region: 590-640
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006134   Gene: ENSPMAG00000005558   Transcript: ENSPMAT00000006163
Sequence length 642
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL478038:22289:32975:-1 gene:ENSPMAG00000005558 transcript:ENSPMAT00000006163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAHTSQNMASGHSLDAEDYSLYSSLGEEELIRMAVEQSLQEPRPQRPRASAGRRGARAAG
EFQTLEFRPQFTRSRGKKKSTSPCLLTSGLFLFVPNMYFSLRWKVASQRLLDPVWEAVSA
DDGTALTRLRRSGAELRAATPHGWMAVHEAAYHDKPCCLGILLQAHPDTVDARSKQNETP
LYLAAYRGHVACVRILLAENATVDACRHVKETPLYKACEINNSEVASLLIARRADVNYRN
IYGNMPLHEATSKGNLELVKLLVAYGAKLQFKNKFGICPFFMAAQCVSLETASPLIEQCV
DVNSEACDGTTVLFEAAKNGHADVVEFLLSQGADPNRPTKDGLLPIHVVAANGNEGIVEQ
LLMPVTDERQVRRSGISPLHLASKNGHSDVLELLLSSGGLDVNATLSMDRSRLYEDCRST
PLYFAIINGDYRCAELLLEAGANPNIDLLNPLLVASRMHAYPLVRLLLNHGANVNAYIPA
RPTAFPATIMVCLRDLRILKLVLERGADGGACFECPFGSGEHPPLPEKLKPWEERLALTS
EASYVQFCEMVASPEINSWAGPIIDTILHFVANVRLCSRLKEQLDTFQEWTLVKDIAGCP
RPLAHLCRLQIRASVGSQRVVLLEKLPLPRPLLNYLRYKDDD
Download sequence
Identical sequences S4RLP8
ENSPMAP00000006134 ENSPMAP00000006134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]