SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006293 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006293
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.06e-33
Family Cap-Gly domain 0.00052
Further Details:      
 
Domain Number 2 Region: 129-396
Classification Level Classification E-value
Superfamily L domain-like 2.18e-23
Family Internalin LRR domain 0.038
Further Details:      
 
Domain Number 3 Region: 486-574
Classification Level Classification E-value
Superfamily Ubiquitin-like 4e-20
Family Ubiquitin-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006293   Gene: ENSPMAG00000005672   Transcript: ENSPMAT00000006322
Sequence length 574
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476511:4183:18658:-1 gene:ENSPMAG00000005672 transcript:ENSPMAT00000006322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDEMPEDVVGRRVLSDGECGRVRFVGEVPPTQGLWFGVEWDDPERGKHDGSHGGVRYFH
CQHPTGGSFIRPKKADLGVPFLSAVRDKYAQLEDNTGELPQEYTSSVGSTSQKIPMQVVG
MEKIFQKQSCLESLKIVALSGLGVNSPGPAEAIREACPNIRDLDISRSLLCSWQEVALIT
EQLCNLSILILSKNRLDIPETPRSLSPCFSHLTVLVLNSCSLTWSQKMKQLTGLAVLLLD
VPVSSREDGNIINSSDVMPLSPVCVCRQVLVCAEMWPNVEHLELLKNNITTLETPVGVLQ
ALRSLNLEGNSLEGNEQINHIAMLPSLESLRLDECGLTSVHFDDVKCGCQTSMFPKLKFL
SLYNNKISEWSSINELDKLQSLEVLNLSLEFLETPEINPNTVWQIIIAKIARLRVLNHSK
VCNNERSGAERDYLKRYGLAWLEAGGRRNGELGIASTEFTAAHPRYASFVHKHGAPEDSE
LKEEVFTLKSKLVAINITCPDLADHKTVEKKVPNSMTVQKLKGMLCRLLKVQASDLVLTY
TSHKMEGQEFELDNDLRPLRFYSIEDGDNLVVRW
Download sequence
Identical sequences S4RM57
ENSPMAP00000006293 ENSPMAP00000006293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]