SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007347 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007347
Domain Number 1 Region: 239-530
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-79
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 129-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 4-68
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000471
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007347   Gene: ENSPMAG00000006661   Transcript: ENSPMAT00000007379
Sequence length 536
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476930:66451:88875:-1 gene:ENSPMAG00000006661 transcript:ENSPMAT00000007379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVECSNLVFTERQGELSSPDYPRPYPRALQCKFTLRLEEGFTFSLAFQGPFDVETHNEID
TCPYDSLTTHPRCGVERGAGIWGMCTVVSNRRARRPIRQSLDRDTDLERAGHTITALVTI
APLSGYRSPHGSIEPVQATYSFKDEVVFSCDIGYRLIQQEDGKEVPATLQVECQKDGTWS
REPPTCRIVDCGKPAQPNKGFCGSPDVTTYKSETDCGCIDAYHFTTEMNGEVVYLFKWYY
TLCRPHTGGGVRCCEYMCGEPKHVIMELSRVVGGRSARPGNFPWQVLVKFMSGRMLGGGG
ALLGDRWVLTAAHVVEDYAANETTVILGSMKRVSLNDNLLGSTQHYTVDKIISHPGYDPK
STGYDNDIALIRLAGDAVTMTDSVRPICLPTVVAGGRVNPELSPNDVAFVSGWGRTAGTL
GARLADTLQYVDLPVVPQVECERANSGKWIAELNTNSTVTENMFCAGYSEGGKDSCQGDS
GGPIVVVQDTKWFTVGVVSWGMGCAKPGLYGVYTRVDKYLGWLRDEMEKNAVKSDY
Download sequence
Identical sequences S4RQ61
ENSPMAP00000007347 ENSPMAP00000007347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]