SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007821 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007821
Domain Number 1 Region: 216-256
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007821   Gene: ENSPMAG00000007090   Transcript: ENSPMAT00000007856
Sequence length 257
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476438:587077:596544:-1 gene:ENSPMAG00000007090 transcript:ENSPMAT00000007856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFHVVHGGNMHMDSTRTHATRVRSFGDAVCMSAQPLPPGRVFLVELSQKETGWCGHLRVG
LTRLCPPALPIPVPPHASPEMEALGGTWVVPISTGLGAQREADALLGMHTNSMFIDAHAS
IVGNHVIVRDSLVGRSRVGRYSHLLDPLFKTHILSTTARGTRIGVIWRILEEEGVMHLLV
NGRDLGVFARGIPTHTPIFAVVDVFGCTRAVTVLHVEYAVPSLQTICRRMIQKLTVNRLA
ISRLGLPAALQCYCQYK
Download sequence
Identical sequences S4RRI5
ENSPMAP00000007821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]