SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009757 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009757
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.21e-34
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 282-333
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000654
Family SOCS box-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009757   Gene: ENSPMAG00000008860   Transcript: ENSPMAT00000009798
Sequence length 343
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL480780:23:7033:1 gene:ENSPMAG00000008860 transcript:ENSPMAT00000009798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAEDAATVLYEASSHGHIDCITLLLQHGANPNIPNATGHLPIHRAAFKGHVRAVKQLLLE
TRERAVERSGVSPLHSAVAGGRVDCLKVLLESGYDPDFLLADHVAVNYTDNRRSALFFAV
CNGDMEATKLLLQAGAKVNQDPMNALLVAMHRGDRETVALLLRHGANVDCQMVVNTTRFP
AALQYAFKDESLLRALLDAGCDARLCFECSHDAEGRRPSGPRDLPGWSSSIIQDTEMCEM
LTLSWVEHLAGRVVRVLLDYVDFVPICVKLKAVLRKHPEWEQISHILENARPLKHLCRLV
IRERMGTLRLRSPAFLERTFLPRSLREYLLYMERGQSIEQGLS
Download sequence
Identical sequences S4RX17
ENSPMAP00000009757 ENSPMAP00000009757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]