SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009913 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009913
Domain Number 1 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 101-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000009913
Domain Number - Region: 141-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0367
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009913   Gene: ENSPMAG00000009009   Transcript: ENSPMAT00000009956
Sequence length 177
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477657:195043:199445:-1 gene:ENSPMAG00000009009 transcript:ENSPMAT00000009956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGCQRWCTQRCVCLFIICLLVVAAVAVAVALGVVYGVPKISGGKLNRECQTTLNQSGFLC
DDRVTCISPSKVCNQRSDCTGGADESKQYCSDPVNTLPSSIIFLCGDGKTWTYTDKLCDM
HNDCGDCSDETGTVSQCPVCGGWRCSTVFFQDCDCIPTTRCRDSVQDCVNWSDEINC
Download sequence
Identical sequences S4RXH2
ENSPMAP00000009913 ENSPMAP00000009913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]