SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010021 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010021
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.67e-45
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 318-363
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000353
Family SOCS box-like 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000010021
Domain Number - Region: 201-323
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00549
Family Tyrosine-dependent oxidoreductases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010021   Gene: ENSPMAG00000009098   Transcript: ENSPMAT00000010065
Sequence length 368
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL482839:11654:16728:-1 gene:ENSPMAG00000009098 transcript:ENSPMAT00000010065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTASRAGMLPCPSQLVLTTPARIAASRGYTDCLEHLLQRGANPDANPGGDAALHAACET
AQDACARLLLEFGANPSACSERGLTPLHHCTSPGSLACARLLLQFSADVNAQSEDDEEGD
TPLHVAARHALLEHARLYLARGAHPDDVNARGLTPLMLVCAHPGVPGDPGARVLAELARA
LVAAGARVDARDPDLLTPLHGACRGAHAALARVLMECGARVNALDYNGVAPLQKVLQVAA
YRQQHIPEVVVQDLLNRGSVKVWPGAFHRVLESCSEAVNTVEVLLNVYGRIKITHAWRQA
IPDDTYQRHAAFYDSVFALQGTPRALQHLARCALRSHLDARCAEVVPRLPLPPRLQSYLL
LEPRGYVH
Download sequence
Identical sequences S4RXT0
ENSPMAP00000010021 ENSPMAP00000010021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]