SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010168 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010168
Domain Number 1 Region: 62-275
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.55e-28
Family Nuclease 0.036
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000691
Family Phospholipase D 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010168   Gene: ENSPMAG00000009239   Transcript: ENSPMAT00000010213
Sequence length 411
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL482037:9048:18939:-1 gene:ENSPMAG00000009239 transcript:ENSPMAT00000010213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADFIDRYKTPRMPWHDAGVAVHGAAARDVARHFIQRWNFTKIVKKKSKRNSFPFLLPKSH
RTSQQLHHSLPGSVATNVQVLRSVSHWSAGVTCHEESIHLAYLSAIRSSKHYIYIENQFF
ISCADNKTVFNKVGDALVDRILQAYRENRTFRVYVVLPLIPGFEGDITTGGGNAIQAVMH
LNYRTMCRGEYSIIERLKAETVSDRWMHFVSFCGLRTHANLDGRLVTELVYVHSKLLIAD
DTTVIIGSANINDRSLLGRRDSEIAVMVEDSEMVPSTMDGRPYQAGRFALHLRTHCFRMV
LGLSDDATVDVSDPVCDRFYKEVWVTTAARNAMVYDKVFRCLPSDEVRNYGELRERQASP
GLASAEPGLAAEELRKVRGFLVQFPLCFLADENLYPSLNSKEGMLPSELWT
Download sequence
Identical sequences S4RY77
ENSPMAP00000010168 ENSPMAP00000010168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]