SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010620 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010620
Domain Number 1 Region: 286-371
Classification Level Classification E-value
Superfamily SIS domain 0.00000000127
Family mono-SIS domain 0.0028
Further Details:      
 
Domain Number 2 Region: 12-159
Classification Level Classification E-value
Superfamily SIS domain 0.00000000964
Family mono-SIS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010620   Gene: ENSPMAG00000009651   Transcript: ENSPMAT00000010666
Sequence length 588
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476557:253805:279336:-1 gene:ENSPMAG00000009651 transcript:ENSPMAT00000010666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMAALEDLVPHTERANPRTHGLDTASPSQLVQLLQECDLEIFQRDDKATAAEEHMTLFGE
STIRLMTDVAAQAKIILENPENNAIVLSGCGTSGRLAFLVAKSFNKLLQDCGRSPCYTYV
IAGGDKALITSQEAQEDQPELGSQQLREVTMDKKMILFIGITCGLSAPFVAGQLDMCLAD
PGRFTAVLLGFNPLSLARTTKVEGWHSSFAQVAERIHSRSISTATSFLLNPLVGAEALTG
STRMKGGSATKVVLETVFLAAHTALNAGVAVSPSCVRECLLSYEAVHKTTYACSPSIAEL
VHRCGTSLQQAGHLYYLGWGTLGIVAMIDASECPPTFGAEDINDVRAFLHGGYQTLGIKE
GDVSSKGQQFFLSHEDFKKNILPCLTDWDTVILIFTGDDDQLEVRCFAETIRARSPHISA
IVHASSEQHLRGELESLFATIVKVTWPTISSHKMDHYLKVHKRYAIKKLIISFIFLKAIT
LLIMKTVMPIARVVNDNGFTTADDVLQKFTGQPRKECLKALLRCIYETEEISEETSNADI
SRHIQVIAHKEKVVPTAMVALLCDCSVTEARRLLSERRVIRDAIEHCL
Download sequence
Identical sequences S4RZH9
ENSPMAP00000010620 ENSPMAP00000010620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]