SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010691 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010691
Domain Number 1 Region: 461-624,652-717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000235
Family ABC transporter ATPase domain-like 0.055
Further Details:      
 
Domain Number 2 Region: 814-1040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000125
Family Extended AAA-ATPase domain 0.047
Further Details:      
 
Domain Number 3 Region: 2044-2078
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000686
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000010691
Domain Number - Region: 2524-2570
Classification Level Classification E-value
Superfamily CSL zinc finger 0.0034
Family CSL zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010691   Gene: ENSPMAG00000009723   Transcript: ENSPMAT00000010737
Sequence length 3245
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476415:18778:89302:-1 gene:ENSPMAG00000009723 transcript:ENSPMAT00000010737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFCSSEREHSHLPTTFDSFRISTTLSFTDSDLKDYLKSHCIVPQGTASVFPDRRNISLVT
SKRAGVGKSLFVQKLVKHSEDLLNNPNMDYVTVRLMDSKINETFLVETFLTRQDNPSDCI
PRVFHVDVTPGVKKGFDTLLMRLFVLGHLQSTDGRVWRCKKSDVYVVEYLDWHPTKELVN
QRKQRGPILLTHVLPTVTCISPLEVLQLYREKTPERFDLPLMDKDLFEQEVYQRPLQYLR
RFTDGANLDAFHFDLGKVEETPMQCLEILLHYCGVSDPSWAELQNFARFLNVQLQDSETS
VYCNVNIVGDTLVGFKHFIVKFMTIMAKDFATPSLELSDESARLHNNRMEDVLETLETYS
IRKRWESQPHPYVFFNADHTSMTFLGFHINATCDAVDPSTYKVLLKAVMTKQLHYGLTLQ
RVPFNINFDNLPRLEKLVRLSRVFGIEYPEDPDENYELTTDNVMKMLAIHMRFRSGIPVI
IMGETGCGKTKLIRYMCDLQKSGREAENMILVKVHGGVTPHFIYKKIQDAEELAIQNEEF
DMDTVLFFDEANTTEAIYAIKEALCDSTVEGRAIRTQRLKIIAACNPYRKHTDQMIDRLE
AAGLGYRIRAEDTEERMGKIPLRQLVYRVQPLPPSMLPFVWDFGQLSNLAEQLYIKQIVQ
RHSRTGNIPTESTQRISAVLSASQEYLRTCADECSFVSLRDVERCLKVLAWFYEQRDTLF
QQMEQLKSAKGEEFVEDDDVTRALILALGVCYHASLEKRQKYRKAIAPFFNCSAKEILNE
IILCQDVFLKSIDLESTIAKNAALKENVFMMVVCVEQRIPLFLVGKPGSSKSLAKTIVAD
AMQGKSARSDLFRGYKQLHLVSFQCSPHSSSEGIISTFRQSAHFQQNQNFQEYVSVVVLD
EVGLAEDSPQMPLKALHPLLEDGCVDEEKPEQYKKVGFIGISNWALDPAKMNRGILVFRG
VPDEKELIKSARGICSSDPVISDIIEILFSGLARAYLSICKAQEKEFFGLRDYYSLVKML
FAFTKVSNEFPSPEELLEAILRNFGGHADMDAIGFFKDHLAEVSFEYDTACISSLKFIKE
NIKKGDECKESRYLLLLTSNSAALNILNTIGNLDMEDTIYIYGSSFPKDQEYTQVCRNIN
KIKVCMETGKTVILLNIQNLYESLYDALNQYYVYLGGNRYVDLGLGSHRVKCRVQKKFRL
IVIEEKAVVYEKFPVPLINRLEKHCLEMNTILEPEQRALTKQLQDWARDFASGSQQNFSA
ADVFIGYHEDACASIVVQQCERHRSDMDESEFLSRAKEVLLQCATPDAVLRHTSGAAGGA
RKVIDLYFEKQKHRSLLELLRYCLQDVHIASNGIHLEISTHSKLLSQLDAENIGNDLKFE
KETVCLLTLQQFETEQEFCQELSNFFKKKGRKLLLLQYIFDDPHISPRLISCAKYCILNQ
KLEDSVERSELFVAFITKVPRVLRGCGYIGFNGGPWWSMHLDELVPPGSFLVDIKSLYSS
SISSLLVSPVLSQGEAEHVQPDLDRQKLESYLYPGFPCGINHPSDWAFTWLKKEYICCRQ
YEIWIENDGPVGLDTRYLLSLCLQPAAAMLEDRADNVQRTMERIPILLRLFGTHSGEQSG
EAEFVTALQTRVAGLLKEQEMLMFSNESWTSRQASSLESILHNGTFRQALWQHLQKVVSS
ALAGVLAAVDQDNNLDLLDESKQPPHIIELWLQILSNENILPFQSIARTMFISRMPLTLN
ITQPHLAISQNSTDSIYWQWKVKQWSSLLYPSAGFKTLGSCPEKMLQRQFDSTPLGQLLA
SLPGDCSEDILTRYSNDFVCMAFQPRRQEELKLLSSALIRAIHWVHHEEEQRSSVPPVVW
LHVVATRARTRLDCFCQLARILPDILTQLCWNTDLTAALPHQEMVLDLDAVQACLELLQP
RQEKLQQREQLWQWSQQVVSFMYSTNIFVPTYHIHGNGNRIKAVIMSCRSQWRHLLVVHM
YTDRLSDITDPKIFGVIVKHLFLLWKGYVESITTVTSMPFSSVVMKAREGKLWVDVFFRG
GVKECRLCREEITDPAALPCEHVFCMKCLRMKFALERNICGVLSRVLIKKFNTLMCSVSR
HIVEQHSGFRKRLTSFFVDIVAQFCFGSGDPPSQEVIQMLLDLLFRDPSEGQDIGKSKTR
GLSPFEECMDPNPVIRSLLLKLLLGYRKRFEDVRQYLDTYLHKMGEATSSEQGDQEELCY
TVIRCIEANAMKATPPHDRRTDSLHAEGLDEDMSRALDRLSTLQLPLQDRTEQDRSIATL
ISIAHIRFCLNVATAVLYQEYSGENQKQQKDSFSQMIHDFILKVCDGDQAENFLIRSVYH
RYGYAFLLNLLSKPQLGWAFPACVLRSRGIDEEAKMLPDRFLVHGAQYCDFRDALAAVGM
SEDSGELHKCLKICTGEASGQMASLPLAVFKEVVLPSMKPHTQPTEQTLTENDCECAKRC
CISEKLISPEPLSHLIGADGAMLKLVVHLAAVLLCSKPSPLLGPLHNLATNTASMATAFL
PTMPDDLKADSFTWEGMQQGWRYECPNGHVYVIENCGQPNFVGNCMECNAEIGGLAHKLL
EGSKRIESAVDQTQTGHVLGDPDARSSLIPERNLPPTAQCLMRALTHSAMLWGYTQDPQV
LKQLIKPAVAVEDIPTFLLGHLQVDLTQLGLALGRNWDDALTTAHLLLTSTAQSHHALTR
WQWCKWNQNLNSKKSRTEWETHFIDECIKPFLEGLDGKLQDVNERMSRDHQMRGNVLVRL
IYASPSSAVPLPSSNVLWRYEARLTPGRLAHLLEKEGGREAHPVLWHVLMQEQKLKLLRF
LPELLQLQQKLISYFRHRPSLNYTTLSVSSFLERFNDERERQVLSAQIDTFWRLWSSVQL
LMKECGSILPEALATAIAGAAPPMSLLLPQEHGLGLCARTVTRILIGLHNDLVEMVQRFS
GHRVRCVGPAEVTAVDALSVDVERDVLPLALSTCEYWLEGGRPTVCDYAFPLLERRLVDR
FLLGKPRIKDIPSFSDKQNYNILTVLITLQKKIAQEPLSVATQRRVMDMLRVVSDVSEVI
FTLTVAVEFLAAVGGDGERPLADYVFNIRAFVQMILYILKVLQLCRIKQSISLWKLLTAW
RAELLLDLKQEPVLLMLDSFQKDLNEDQQEALEQRLPGGRMEGLILELHAFVLLELRPKQ
HSNIYNPTWSLADTLRAHLERQGERDEAVDSVCRLLPDDVTLGQVLAVWKAAVECRRRTT
QHRLV
Download sequence
Identical sequences S4RZQ0
ENSPMAP00000010691 ENSPMAP00000010691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]