SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000010794 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000010794
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-57
Family Nuclear receptor ligand-binding domain 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000010794   Gene: ENSPMAG00000009820   Transcript: ENSPMAT00000010840
Sequence length 175
Comment pep:novel scaffold:Pmarinus_7.0:GL478396:56489:61445:-1 gene:ENSPMAG00000009820 transcript:ENSPMAT00000010840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RELHTEDQIALLKSSVIEIIILRSNQSFSLEDNSWTCGSNEFKYCITDVTQAGHSMELEP
LVKFQVGLKKLNLHEAEHVLLMAICIFSPDRPGVTDRDRVEACQERLSETLRTYISCHHP
PPGGHLLYPKMVQKLADLRNLNEEHSKQYLEISRKEGVVDDLTPLLVEVFGSPLP
Download sequence
Identical sequences S4S003
ENSPMAP00000010794 ENSPMAP00000010794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]