SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011066 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000011066
Domain Number 1 Region: 648-796
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.54e-46
Family Toll/Interleukin receptor TIR domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 30-202,370-561
Classification Level Classification E-value
Superfamily L domain-like 1.56e-37
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011066   Gene: ENSPMAG00000010085   Transcript: ENSPMAT00000011112
Sequence length 822
Comment pep:novel scaffold:Pmarinus_7.0:GL477734:53776:56244:1 gene:ENSPMAG00000010085 transcript:ENSPMAT00000011112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLLKYAVVVFCTAGPWAGVGISGTKAKNCCCRDNGDYSQCDLAAVPRALPATVTVLDL
SHNRIGAIRLGDFSSTPKLEVLILAFNRIRTIEAGALRDVPLVRYLDLYQNELPAVPEEA
LIDLPNLQTLNISMNNYTSFALGGAFSRMSQLQSLSIGTSHTSELHASDLQALSSIPLKH
LWLNTGSPLKSYEQGALANLAHLEKLFTNVSIDDDLSILSKMLLDLGTTRISEITIMNIL
INQVHNQSIDLFSGLAYCPLLKNVMLISANLTNLDIVSLLKNIYLSEVTSVTLTNSSYTD
FDNVVFPNLPTERKAALETVIIDGIFHMPMTYPLFYIPFSLFPNFSKFKLSNTGLNKVDC
LFMTFPGKILDFSNNLLVEDGMWLPKCPQKDNLINTTHLIISHNRFSDLNTIAQKVVVMP
NIKSLDLSYNSINHIQECSAWPSTLETLILRNNDISKDSKICISEYLQVLDLSYTRLETF
TQNILNDGKSLRELYLSGNNIKYILPELYSPSLQVLYVDNNGVGIIGENTFRGLENIKTL
YLGNNPYYCFCDLYWFQQTFEKQLLKNWPNEYRCSYPNELSNRTLSDLNLSIITCDKRII
ISMSVGITAFIIILILGLGYYFDAIWYIRMGTVWISAKRRRMQQGAGGPFQYHAFISYSQ
LDSDWVENTLVPTLESSNPDLKLCIHERDFMPGEWIVDNIIQCIEHSNKTLFILSRNFVN
SEWCHYELYFAQHRVLEQRQDSLVLLLLEPLPRNSVPSKFCRLRKLLNRKTYLEWPAEEG
KRSMFWASLRAVLQSDHEPSNPNSNHRSISTCNSNPIRNPYV
Download sequence
Identical sequences S4S0S4
ENSPMAP00000011066 ENSPMAP00000011066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]