SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011080 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000011080
Domain Number 1 Region: 373-700
Classification Level Classification E-value
Superfamily L domain-like 1.09e-47
Family Ngr ectodomain-like 0.0077
Further Details:      
 
Domain Number 2 Region: 786-935
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.46e-44
Family Toll/Interleukin receptor TIR domain 0.0000123
Further Details:      
 
Domain Number 3 Region: 52-360
Classification Level Classification E-value
Superfamily L domain-like 1.6e-36
Family Ngr ectodomain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011080   Gene: ENSPMAG00000010099   Transcript: ENSPMAT00000011126
Sequence length 935
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL480142:3362:6166:-1 gene:ENSPMAG00000010099 transcript:ENSPMAT00000011126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLASLGLVAPPATLGFFLRKCIQDARFETSVACVDARITDARDAIADLHGSPRSLNLSR
NEIAQLTSGGFKNLSRLVNLRLDRNRIRSIQPGAFEGLKSLLSLNLTGNDIVYLEADAFK
GAEGLLELLLAGNTLKVAPEPFQLLRHLVNVSLMENSLCDFSRVVEAVSGLPSLRSLDLD
GNNFTVLSVSRASIRLPRRVRSLHIAGCGVRKIELPGDFFANVAFLDMSGNNLTDASGLA
ALNLSRVEEVSLGANNLSSGALKQLRSLSPTTLHMTSAGLSGTRSLRSLCNSTLGRRVST
LTLLSNDIRAFTDAFTWCRELASLDLSSNNLKSMGKYELVNGSSSLRDLTVQHNHLTSLD
SCWNSNANTLRCANLSQLETLSLAYNRITHLDGHALIHAPNLLSVALNFNTIANINLTAF
AGLIRLVYLRLDNNLITDIRKQVFHGLENLKTLNMRNNKVTTIFPHTFTFLRHLQILDLG
GNHISSLMHNAMSRLYSLRNLYLDRNFLRIINSHMFNGLHSLHNLDLVRNSISYKYRSQS
NAPFVNLTNLTTLKLSAQQPYGLQSIPVDLFKGLRSLKYLYLAGNKISFHNTLPFDELVS
LKYLGMQDVCSGLQNMNANMFQKLTQLGTLDLGNIGINFLNKKQFQNQSNMRVLYLSANG
IRAMIEDVIAPMKELRYLDVTSNPLQCTCDNAWFKNWSRSSDVQVVGLYGVSCSGDNGAA
GNSSRLFVDFDASVCYEKWGRVMFVLTLPFFSLLTACPLVFVKARWHIRYGYYMFRAWFR
EYRRRDEDARAYDYDAFISYNSRDEDWVMGELVPRLEQEGPPFCKLCLHHRDFALGKYIV
DNIVDAIYRSRKTVCVISRSYLESEWCSWEIQMAAYRLFDEHKDVVIMVFLEDIPDYKLS
AYHRMRKIIGDKTYISWPEDAAGKDLFWAKLRAAI
Download sequence
Identical sequences S4S0T8
ENSPMAP00000011080 ENSPMAP00000011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]