SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000011211 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000011211
Domain Number 1 Region: 657-801
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-45
Family Toll/Interleukin receptor TIR domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 48-175,348-383,413-579
Classification Level Classification E-value
Superfamily L domain-like 2.45e-44
Family Ngr ectodomain-like 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000011211
Domain Number - Region: 229-424
Classification Level Classification E-value
Superfamily L domain-like 0.00561
Family Internalin LRR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000011211   Gene: ENSPMAG00000010230   Transcript: ENSPMAT00000011257
Sequence length 807
Comment pep:novel scaffold:Pmarinus_7.0:GL476415:333171:335591:1 gene:ENSPMAG00000010230 transcript:ENSPMAT00000011257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRMLMCTPVILCLMGFIKASLREMNDPASHCHIKDEGRTADCSHRGLTHVPRGFSADIT
RLDLSYNNIKALEVGDFSSTPNLQVLTLAFNHIQKIHPQAMATLKRLYYLDLCQNNLSEK
PGEALGSLPNLQVLNISMNNYTSFALGVDFSRMSNLRDLTIGTSKTTTLNASDFQALESV
PLKYLNLNTGSPLWVYETGALTHLRSLEKLNTNVSVDKDPLVLSKMLTDLNNTNISELEI
FRILNNPLKNASIDFFKGLGSSNLLKNMTLIEANFTDKEVSNLLKNIYLSELTMLVFKNS
SYTDHYPVIFNGVKNVTKRSSLKKIVIDSIFHLNMTYPIFIVNMTLFPNISQLKISNTGM
NKVDCFFMKMKAIKQLDFSRNLLNEGGLWWDSCNYTVILPEATELIISHNYFKDLKKISE
MVSLMPRINSLDVSYNGINYIEECRWPSSLERLILRNNEISKESVICTSANLKFLDLSYT
RLESFPNYILTNATSLQELHLTGNLIKYISSDVKSQSLQVLYVDYNAVGIIGQGTFQHLQ
KIKSITLGNNPFYCMCDLYWFRQRFNKTLLNGWPNDYTCSYPEYLSGKEMDYFNPNILNC
DRIIAISVSVVVTVVVIALVIGIGHYFDAIWYIRMGFIWVSAKRRRYKIISGEEDLPFQY
HAFISYSHLDSEWVQNTLVPTLEHSNPDLRLCIHERDFTPGHWIVDNIIQCIEKSSKTLF
VLSRNFVNSEWCHYELYFAQHRMVEENQDSLVLLLLEPLPKGSLPSKFCKLRRLLSNKTY
LEWPTEERKRAVFWTSLNAVLQSRPPP
Download sequence
Identical sequences S4S169
ENSPMAP00000011211 ENSPMAP00000011211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]