SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294881763|ref|XP_002769485.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294881763|ref|XP_002769485.1|
Domain Number 1 Region: 98-188
Classification Level Classification E-value
Superfamily Rubredoxin-like 6.83e-20
Family Cytochrome c oxidase Subunit F 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294881763|ref|XP_002769485.1|
Sequence length 258
Comment cytochrome Coxidase subunit, putative [Perkinsus marinus ATCC 50983]
Sequence
MTLLTRTFTRSLGASLLSNRATLLSNKQQSRWYRHWHRMSEDDWALPLDSMPEDVKTLMA
TPQTERGFVEDYWYNRIRGEATLLDPEALPSKSYIDLARDMGLQIVDEPSSHMMGLIELY
EYLRGASFVGPFGTIENPVLVPAVGQERVVACTGGVGDEEHFTLWFRCREGFMYRCGECD
QIFMLVRLYYEDRYWTQTLVRDTFMSDGDMFDLKTLERVHKMWNKDEMVRWEVGYWAQDY
VLGKGVLPGMVEEHTRVN
Download sequence
Identical sequences C5LM72
gi|294881763|ref|XP_002769485.1| XP_002769485.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]