SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294886121|ref|XP_002771567.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294886121|ref|XP_002771567.1|
Domain Number 1 Region: 287-351
Classification Level Classification E-value
Superfamily RING/U-box 0.000000835
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 101-137
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000301
Family CCCH zinc finger 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|294886121|ref|XP_002771567.1|
Domain Number - Region: 142-175
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000353
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 382-409
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0981
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294886121|ref|XP_002771567.1|
Sequence length 599
Comment hypothetical protein Pmar_PMAR014600 [Perkinsus marinus ATCC 50983]
Sequence
MVMSYPEHDMENGDDTKTTKSERTMSASTTADAGSPSALLRLVENRRPRRESEDSVKSKL
ELAIRRTSCSPLTNAGTKSAPDGTLLVYRTESMATAVKANAFLKTKMCPKLRMNANGVWT
CPQGDRCSFAHSEAELRSLPNLTKTAICYEQVYGKCGCKNGARCKYAHSEEELRKYIPLS
TSNSRSPGRPRHGSGDSVNTTKRKNSRASELVGLCNSGSRSGRRCGKESVSSCTKTAVEP
KPIDLPSLRSRALEIARELPASRGKHLEISRSQLVDQLDDPCIAQYMCSICGALASPTPD
PTIASACAHMTCARCFEGWRRANVEQEPKLKTLPCPSCGCPLRKGIDVFPFNESIEGPIA
ALLRVYSKIRIRCQKVDELSNSPPCEWVGSVRDFPEHMVVCHHWECMLETLPSSSLEHDA
GAANEDRPMQFNHGTLHGHRGTISSSAAADITPMWDDISPSADSGNLLKIPPASADASST
GFNEQLLILSPSPVVDSHGHPSAAASASTATTITGALGGIWRTQQLDGYSGSSSNCSEMM
TCITPEKVSLLPGSGLGEEPDDKHVEELALAECEVICDFIPYGSSADKMLEIFEGETLL
Download sequence
Identical sequences C5LIH9
XP_002771567.1.22384 gi|294886121|ref|XP_002771567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]