SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294890721|ref|XP_002773281.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294890721|ref|XP_002773281.1|
Domain Number 1 Region: 748-823
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 438-510
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000123
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|294890721|ref|XP_002773281.1|
Domain Number - Region: 691-740
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0059
Further Details:      
 
Domain Number - Region: 612-660
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0994
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294890721|ref|XP_002773281.1|
Sequence length 926
Comment hypothetical protein Pmar_PMAR026531 [Perkinsus marinus ATCC 50983]
Sequence
MGHKKKTKPKQQPDGDAANVEQSPAPTLSTPEDTLERKSASSDSSGGFVMSTSARRRKNK
LRNEQKAKDAAGVVTVPSEANLPAIPTEPAAHFEELAAKLKEEASLMKLSKTDRSSSDEF
IRKLAHVVEAERARLQPKPSFRGTVQQLRLQIYDLSTALGCFESTDSIDAKETKAMLTEL
ESQFVRLVEQEAFRSFQQRVNAIKNTVERQQQQGQSRKESPAKPSRPPRAPQDGGMGRVA
HRLQQILGLEEVPPLEQLHTKEITRDAGVSSALLDVLLPNGGSSQLAQKWEKEYRVCLQP
VFGEKRSVRGIKVTGIKEEAVEGALRKMETFNPVVSRSISLVLPEHGSASPNVLNSIRRR
VFQLAPQLESRHGVVIVKDAKGDSVTIYSPEAEKVDKIVEELHTAMSERPRPRTGSSGGG
DHKELGGRRGEFRDTSLKLEVGIAKCVVGDRGENIRRLEFLSKCQIHIKGPPPDANAHKN
TGIAHVTIRGASANDVATGLKMVREYANSVGKRVVKCSNKEVLDRLFGAGQGGHTSVASR
FATIRRQCGCTILRDSDTTLQVLLPFNDDPTLEKELDAAVKDIQHLVEEASLAVEKVPVS
SEHSHIWEDTGNLRSIQRKSGLIRLTLRKGGDGQEAHLELLGNAQAASKARVLIEKLIDT
SGTAERFETLKECKGDGDLAEAVVNMLSANGQATLHQIARDSGTKLYVEESGDGKNVKAV
GGPTEVALAMKLLRRAVAEHKALLALMTTVQVAIPHDKVASVVGPSGRTLHKIQKLTLCT
DVQLSKRGAGGGVKERSAAVCVIRGAEEAVKKAEAMLKEIIESGMSSALQQNGVVAAGDS
PTAAETKFVGARDAQPRLRNKTRGSAWGGGGGAAGGEGASSSKSRGGAVAKAVKKDFVFD
ESDFPALPGKPKEEKPAESLRKDSSK
Download sequence
Identical sequences C5LDT3
gi|294890721|ref|XP_002773281.1| XP_002773281.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]