SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294910790|ref|XP_002777948.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294910790|ref|XP_002777948.1|
Domain Number 1 Region: 251-338
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 88-166
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294910790|ref|XP_002777948.1|
Sequence length 424
Comment hypothetical protein Pmar_PMAR020037 [Perkinsus marinus ATCC 50983]
Sequence
MQRKGPAVSGVQQNPAGPRTASRGNPSGPGMAFEFGPDAGPYRDQGDQSTREQGYTIFYV
DAQSEEQLQAAVDAIREKISPLEPKDGEIQRFFEIPDSKVSEVLGPQGVALARIKERSGA
RLEIRAIPPAEYHGSTRGMPRTVNCVGTEEAVNKCEELVNKVVAGTVTCADLISEYEVGH
PEVRSQKRLSSTPSYDETKRRRMDYDDYQRGGFDNSYNAGYQRGGGFGGSRVGGPMKGGG
KGAWNDNSAAADFCILEVPSNGVGAIIGRGGEIINRLKEDSSCDIQISKSGAGPYREVSL
QGPHDGIITVVGFINERLAGAHVVKAAPANGLPPYLFGSGDGAPRGRMGSGGPQPYMQQQ
GPPSTARSYGMQGGPPEAYSTPPGQPWQQPQMEGYSAGNSMMPQYQQQPPPYAGGLCTRI
PCDW
Download sequence
Identical sequences C5L0J5
gi|294910790|ref|XP_002777948.1| XP_002777948.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]