SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294954873|ref|XP_002788337.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294954873|ref|XP_002788337.1|
Domain Number 1 Region: 748-822
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 2 Region: 435-504
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000118
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|294954873|ref|XP_002788337.1|
Domain Number - Region: 684-748
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294954873|ref|XP_002788337.1|
Sequence length 903
Comment hypothetical protein Pmar_PMAR026723 [Perkinsus marinus ATCC 50983]
Sequence
MPYRRRNNKSSATASTTGVKPVSTGSILAKEPPAAVAMSPVPTTVGADSPLEPKSPMDPI
ESPQPAMSNAARRRRRRRRAHKEVVQEELEEPEPVELTKSQLKRKKRLQRKAEAEQDQPR
SIKADPSLFPPVPDYPSKAKMDAIISATTKNKLRDLEWAEFQSLVNSLDKQVEEIRAELP
PKPKDKRQTTMRLRQQIYELSQLPPSDEVTGMLESAEEELIPTAAHEMFKNLQHRMVLVK
KELSEGQEEQREKKRQQREEAIESRRAARLGKMLRQEVTHLHEAELPMISTGFEDGVQAR
LIGLLFPPEGQPSILPRLERFTTALLEPLYGETGLVRGVRVSANSEESLTSAVQQLKHID
VNNVVRVPIPNDVPGARRRAGDVVRKLEASEQSLFITFGNADIAVHGPVNGTAVKQAGDD
IKAAMRAAADRAQNSVTRVVTADTETLRCVMGDGAMGLRKIQSQSGCSIQARFNDQHATV
TVRGPTEAKVNEACKALNDAIKEVARVEVPVKTDEQREKLFAANGLLAPRLSVIKREYRG
GCRFVKEADGKKITVMSQTQEEADQAGKELRKLVEEAAMTFETIPVPSDHVSVWMRPANV
ELLRLKNHLTRAFFQRGGKGAGKGNSGPTLELVGTPEAVANAKKDIPKVVTDAEVTETFA
VLGACSGDGKLVDAVIGTLMRDRAARLNQIGKETGTNLTLLGGSGKGSGRSPVSRGQNGM
RRDIRLVGSKADVVQAKRMLGQLVNDLKDATSSTETIEFTIPEDTVRLVIGAKGRTIQRI
KAVSGVSSIDFEHAEEGVSKCRISGQLESISRAEEMVKAISAGERVDFTKKVEEQGSSEA
PAIESAQPGPRVLKAQAGFKPSNNDKRTGKRNQQKAAAKADSGDDEEFPALSAIVRSGLA
AAD
Download sequence
Identical sequences C5K5X2
gi|294948288|ref|XP_002785688.1| gi|294954873|ref|XP_002788337.1| XP_002785688.1.22384 XP_002788337.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]