SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003703 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003703
Domain Number 1 Region: 315-442
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000315
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003703   Gene: ENSPMAG00000003381   Transcript: ENSPMAT00000003719
Sequence length 455
Comment pep:putative scaffold:Pmarinus_7.0:GL477225:28608:47529:1 gene:ENSPMAG00000003381 transcript:ENSPMAT00000003719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDAYRTQRRAAQPPKPQSSMPFLRGDQKPPPAAQHQRQQGQATKERVKLLNGEIASQQR
IIQQASQALNCCVDEDHGKGSVEEAEAERLLLISTEKRLALLIELNDLKGQQAPEDGQQQ
PARSDARMAPSKAEVCRGTVLVSNVCLPLKADFVCSLASKPDRCNYYFFVLFRHGSTDVV
ATPLASTLHSMDGDSLAFPTKFSLEGVQSDFEIDVEVYSLAQRKDGEPSDKRRRSTKSKV
MTPKKLLTSITRNHPYSPAMSSAGGPNAVRVSNFSLVGSHKITRASLGTSRFLLDKVPFL
SPLEGPIFLKVECRAASAVEHRGFLTVFEDVGGLGAWHRRWFVLAGMRLSYWTYPDDERS
KEALGQVRLAEVEEPRVGPASREACARPNTLELRTARAARPHDCQTLVRKRKDALLVSRY
WLSADTKEERDLWMNKVNQVLLDLRTWQPRSSCKP
Download sequence
Identical sequences S4RES1
ENSPMAP00000003703 ENSPMAP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]