SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003750 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003750
Domain Number 1 Region: 329-707
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 6.15e-126
Family Oxysterol-binding protein 0.0000441
Further Details:      
 
Domain Number 2 Region: 69-191
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-24
Family Pleckstrin-homology domain (PH domain) 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003750   Gene: ENSPMAG00000003422   Transcript: ENSPMAT00000003766
Sequence length 832
Comment pep:putative scaffold:Pmarinus_7.0:GL501270:67458:91820:1 gene:ENSPMAG00000003422 transcript:ENSPMAT00000003766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSEREKEESDISRDDSFTVTKSKSESGLYNGNETSTPTVKLTKKESLKVQKQNYKQEKKR
ATKELLSNLKDPTVVIMADWLKIRGTLKSWTKLWCVLKPGVLLIYKSPKNEHWVGTVMLN
VCQLIERPSKKDGFCFKLFHPLDQTIWAVKGPEGETVGAITQPLPGSYLIFRAISESDGR
CWMDALELALRCSSLLKRAVVKDGKEAELNNSVDGGHMGLLQLLRASAPFSPQEKFTLNE
SEIESAHFGSHHLPWEGSGRSNGGDGQREESDEDGTADKTDDSDSDVSDRPDAAVSNGSP
PEPVVETGYVAELGEEFGEVGEAAQTETVSEENKGLIWTLLKQLRPGMDLSKVVLPTFIL
EPRSFLDKLSDYYYHADILSQAAVEENAYDRIKQVVRWYLSGFYKKPKGLKKPYNPIIGE
TFRCMWIHPQTSSKTYYISEQVSHHPPISAFFISNRKDGFCISGNILARSKFYGNSLSAI
LDGEGKLTFLNRGEEYLMTMPYAHCKGILYGTMTLELGGKIIIDCEKTNYKAEIEFKLKP
FLGSSDSVNQVSGKIKLGKEVLATLQGHWDREVLIHELSSGVTEVFWHPTSDVRHQRLQR
HTVAMHEQGEFESERLWQHVTRAIQDRDQNRATQEKFVLEEAQRNAAKERKESNSEWTPK
LFRQDPITGAWCYKYADTRPWDMLNDMVQFERDGVIQTHMRHRAAHSVASLAVPSASHKG
FQTVGPDLKPLKGGLRHRKNPLPDHQHLDSSDNDDVRSHGSRSRRRHGLVEIHEAIDSVR
KTQEEINKNLAFLARRVLPSHPAEEESLLQARDWMLIFLLLLSQLLITYIFK
Download sequence
Identical sequences S4REW8
ENSPMAP00000003750 ENSPMAP00000003750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]