SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003817 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003817
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003817   Gene: ENSPMAG00000003507   Transcript: ENSPMAT00000003833
Sequence length 198
Comment pep:putative scaffold:Pmarinus_7.0:GL480425:6508:17018:-1 gene:ENSPMAG00000003507 transcript:ENSPMAT00000003833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRCGQPETPAHVDVLGLDISTLGYTLVYTCQKDFFLAGGSEHRTCGPNGTWTGKPPVCNA
GKKYRDKVIPSDLGHFNPKPPVPDTVFAENYTWKGFYDHLGQKNSMTLVVNGFNMATGRV
NITFSDNSVTLKLAGNYKRQEARLSLQIWQITSQASAAKFKGSNWIMDGYVSAEHESFVY
QGSIRANGFGQFGVQRLG
Download sequence
Identical sequences S4RF35
ENSPMAP00000003817 ENSPMAP00000003817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]