SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005102 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005102
Domain Number 1 Region: 995-1122
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-18
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005102   Gene: ENSPMAG00000004601   Transcript: ENSPMAT00000005121
Sequence length 1138
Comment pep:putative scaffold:Pmarinus_7.0:GL476931:215398:230121:-1 gene:ENSPMAG00000004601 transcript:ENSPMAT00000005121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STPVLQKLLERTRARRELLQQKMAEQGLGEAGCTSPSKRARDPLTDTANSSGHSPGEQSG
VADLGGSPPKKRYSGGVDTENVLPRDPAPRYTQCIHSVVNEYSRAQPMPEKAETTHDPGV
LTHHSGSMKTRMQKLAEQRRYWDGDAPDESASVSSPVSFNHSRAALVAPPNDQPDATGRP
SRSAARSRLANLAATINTWEDDLGHGSAASSNGDVTSTANKPKSATATSVKVSVTAAKPP
VAAARTTVNRTPDKAPVKVGMTKSASGNVALATVRAATPERPYSSLDRSKPAMSTAAARQ
ESQPQVMNTLKPLTSAITRMNARPIVNKTITPGTPAQTASTPSTPGDITLTLVINFLFGS
LNHAANGSGVKTFRERFEERCQQQSVTPTVAGHAAGGRTITVTSGDGARALHDRFRHVQG
ETAAASHADKLKQEREQELAMIRNRFQKGSVWANEKKGPVSDATSDKGSSVVAGGSVAKA
PVTPAREGNGQKSVETVQRSNALASPATAVQKTPAGFASETEKLGPESTGDSDIDSRSCQ
SSNDVSDSEEEENNSGVIDELFDDLLDDVVEGSETKGTVETRGEVTTALSKEAARGGKKN
QESEDELEVSSMSPLSESINTAVHSPEQKILMSSPLPPSSAKSPSAPSSPEAPSAARRNT
RARLRRSGSLDSLVPSEEPRLLYSIDAYRSQRMSLHRRSPVKQASPRRNNARAEERPKNS
PRVLSLRERLHLLTNEVNSQQSIMQQARTALGCCVDEDHGKGSLEEAEAERLLLISTEKH
QALLAELNRLKANASARSGGRGGGGGGASTTPGEQTAPCRGSVFISDIRLPLKPEFVCVL
ASRPDQSSYYFVVLLRQGAENIVATPLVAAHSPPNGDTLTFPTTFTVQDVGSDFGISLEV
YCLSQKKDANAPEKKKAKKQGLTPKKLLSSITKSGSNLHSPSIVIGGGTRPSGFVLVGSH
RLCLSSVGKAKFPLEKVQRMSPLEGNVYLKFQCRVDSSVEERGFLTMFEEVSGFGAWHRR
WCVLSGNCLSYWTYPDDEKKKDPMARVNLATCVNRLVEPVDREFCARQHTLELVTVRSQH
PNDRETLTTHMRNRQCVTKNWLSADSREERNLWMEKFNQVLINLRTWQPEACAGAATR
Download sequence
Identical sequences S4RIS0
ENSPMAP00000005102 ENSPMAP00000005102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]