SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006441 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006441
Domain Number 1 Region: 172-251
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000104
Family DEATH domain, DD 0.0066
Further Details:      
 
Domain Number 2 Region: 6-107
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 0.000000000719
Family TRADD, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006441   Gene: ENSPMAG00000005845   Transcript: ENSPMAT00000006470
Sequence length 252
Comment pep:putative scaffold:Pmarinus_7.0:GL477323:362386:365380:1 gene:ENSPMAG00000005845 transcript:ENSPMAT00000006470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGDSDNPPVILKVHSTLFGVDLRFDSTASCSAFLERYVNGDMEVQLNRGLAPKHQDSFTT
SLQVRGLHSDQLISSHDSPALLSSLLPPQPTALQDDEVKKMQHDLLMLNLNPRDASGGDL
VNSNAGPSSSCQLGGIPTHDACLSAPMVIPDNTFIFQEKLYDDRPISTDDHNNFAKKVGP
GWKAVARQLMRTCKGLEDPTIEIITCEYNGVYEQAFQMLRKFMQSEAKQATLSRLVKALE
DERLCNVVEFLL
Download sequence
Identical sequences S4RMK5
ENSPMAP00000006441 ENSPMAP00000006441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]