SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007480 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007480
Domain Number 1 Region: 61-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000384
Family Phosphotyrosine-binding domain (PTB) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007480   Gene: ENSPMAG00000006777   Transcript: ENSPMAT00000007514
Sequence length 203
Comment pep:putative scaffold:Pmarinus_7.0:GL476796:48883:57309:-1 gene:ENSPMAG00000006777 transcript:ENSPMAT00000007514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHNSSSSQGSEISAKSKSIDSSLGKLSRSSTVASLDTDSTKSSGKDCSVANSS
ANIAEFRVRYLGALERVRVGDYGALHTPADIINCIDLAQQYGKLPFVASEEEVTLLVSKH
GIKMIAADHLDVLQRHPLYLIVLTVCFDDGFGMGKHLLALKTAESHRTEQSLWVYQCSSL
DQGQAICRAMSSLFDVVLGAVKS
Download sequence
Identical sequences S4RQJ4
ENSPMAP00000007480 ENSPMAP00000007480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]