SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000008782 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000008782
Domain Number 1 Region: 250-403
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-43
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 15-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-31
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 124-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000072
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 158-254
Classification Level Classification E-value
Superfamily SRCR-like 0.000000209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000008782   Gene: ENSPMAG00000007982   Transcript: ENSPMAT00000008821
Sequence length 408
Comment pep:putative scaffold:Pmarinus_7.0:GL483501:677:9907:-1 gene:ENSPMAG00000007982 transcript:ENSPMAT00000008821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHVNIPLDCASTADLWEPNTTFSSPNYPNNYSVNTLCFWFLRAQEGDNVQLHFQDFDTET
HNDMVMVYDGNSTSAMLIGMFSGSGPGRDLFSTGSVMTVRFRSDFVTNSKGFLANFTTGF
RLGMPPLCGNDESQCDNYQCVPSSAVCDGRPDCTDTSDEKHCARLVNSTVVASGVVQLYV
HGRWRGLCANDSLEELARNTCLSTGYPGLNGSALVAAAGYGPYVSLFNSSSSSVGAVISE
SCDAGRVLYVNCIPKACGRRRLVPESRVVHGSDAAPGAWPWMVDLRSKERHLCGASLLRD
WLLTAAHCCARGRHEAVDLTAAFGLRSQLNFSSSVVEQRLVAQVHMHRDYNHYSKDNDIA
LLRLASPVNYTDEIQPVCLPEGREQFFPGTFCYVAGWGLINNAGASRE
Download sequence
Identical sequences S4RU92
ENSPMAP00000008782 ENSPMAP00000008782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]